PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G222600.1
Common NamePHAVU_008G222600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 240aa    MW: 27489.9 Da    PI: 6.679
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G222600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171055147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        +g+W+++Ed  l ++v+++G+++W+ I++ ++ gR++k+c++rw + 
  Phvul.008G222600.1 10 KGSWSPQEDATLMKLVNEHGPRNWSVISSGIP-GRSGKSCRLRWCNQ 55
                        799*****************************.***********985 PP

2Myb_DNA-binding53.45.7e-1764106347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         ++++ Ede++++a++ +G++ W+tI+r +  gRt++ +k++w++ 
  Phvul.008G222600.1  64 PFSPMEDEIIIKAHAVHGNK-WATISRLLS-GRTDNAIKNHWNST 106
                         89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.545560IPR017930Myb domain
SuperFamilySSF466892.81E-298103IPR009057Homeodomain-like
SMARTSM007177.4E-15958IPR001005SANT/Myb domain
PfamPF002497.1E-181055IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-241163IPR009057Homeodomain-like
CDDcd001672.15E-131254No hitNo description
SMARTSM007174.0E-1461109IPR001005SANT/Myb domain
PROSITE profilePS5129419.50561111IPR017930Myb domain
CDDcd001671.05E-1064107No hitNo description
Gene3DG3DSA:1.10.10.602.3E-2264110IPR009057Homeodomain-like
PfamPF002491.7E-1364106IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MRDGGDDRVK GSWSPQEDAT LMKLVNEHGP RNWSVISSGI PGRSGKSCRL RWCNQLSPDV  60
RHRPFSPMED EIIIKAHAVH GNKWATISRL LSGRTDNAIK NHWNSTLRRR GTTEHSSSSS  120
AASPSTKRPS PLELCYPLKK QRVEKENEEE CMAIPLMKPL SLFPSGEKSE GEMMEEEEKE  180
EEREVEEFEV NNINTASDQD YFLQMMQQMI ADEVRNYVDS LRHQRQHEII HPGLKFHPK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-3591103104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007141751.11e-180hypothetical protein PHAVU_008G222600g
TrEMBLV7B8551e-180V7B855_PHAVU; Uncharacterized protein
STRINGGLYMA02G43280.11e-93(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF116002935
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.18e-55myb domain protein 73